Class g: Small proteins [56992] (90 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (4 proteins) |
Protein Insulin [56996] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries) Uniprot P01308 |
Domain d1lnp.1: 1lnp B:,A: [74048] mutant |
PDB Entry: 1lnp (more details)
SCOP Domain Sequences for d1lnp.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1lnp.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens) [TaxId: 9606]} fvnqhlcgsdlvealylvcgergffytkptXgiveqcctsicslyqlenycn
Timeline for d1lnp.1: