Lineage for d1lnp.1 (1lnp B:,A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888633Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 888634Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 888635Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 888640Protein Insulin [56996] (3 species)
  7. 888650Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries)
    Uniprot P01308
  8. 888784Domain d1lnp.1: 1lnp B:,A: [74048]
    mutant

Details for d1lnp.1

PDB Entry: 1lnp (more details)

PDB Description: nmr structure of human insulin mutant his-b10-asp, pro-b28-lys, lys-b29-pro, 20 structures
PDB Compounds: (A:) insulin A chain, (B:) insulin B chain

SCOP Domain Sequences for d1lnp.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lnp.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgsdlvealylvcgergffytkptXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1lnp.1:

Click to download the PDB-style file with coordinates for d1lnp.1.
(The format of our PDB-style files is described here.)

Timeline for d1lnp.1: