SCOPe 2.05: Domain d1ln4a_: 1ln4 A:

Lineage for d1ln4a_ (1ln4 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.4: YhbY-like [75471] (1 family)
   automatically mapped to Pfam PF01985

5. Family d.68.4.1: YhbY-like [75472] (3 proteins)
   Pfam PF01985

6. Protein hypothetical protein YhbY [75473] (1 species)

7. Species Escherichia coli [TaxId:562] [75474] (1 PDB entry)

8. Domain d1ln4a_: 1ln4 A: [74043]
   structural genomics

Details for d1ln4a_

PDB Entry: 1ln4, 1.5 Å

PDB Description: crystal structure of e. coli yhby

PDB Compounds: (A:) Hypothetical protein yhbY

SCOPe Domain Sequences for d1ln4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ln4a_ d.68.4.1 (A:) hypothetical protein YhbY {Escherichia coli [TaxId: 562]}
mdlstkqkqhlkglahplkpvvllgsngltegvlaeieqalehhelikvkiatedretkt
liveaivretgacnvqvigktlvlyrptkerkislple

Timeline for d1ln4a_:

• d1ln4a_ first appeared in SCOP 1.61
  
• d1ln4a_ appears in SCOPe 2.04
  
• d1ln4a_ is called d1ln4a1 in SCOPe 2.06
  
• d1ln4a_ appears in the current release, SCOPe 2.08, called d1ln4a1