Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.4: YhbY-like [75471] (1 family) automatically mapped to Pfam PF01985 |
Family d.68.4.1: YhbY-like [75472] (3 proteins) Pfam PF01985 |
Protein hypothetical protein YhbY [75473] (1 species) |
Species Escherichia coli [TaxId:562] [75474] (1 PDB entry) |
Domain d1ln4a_: 1ln4 A: [74043] structural genomics |
PDB Entry: 1ln4 (more details), 1.5 Å
SCOPe Domain Sequences for d1ln4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ln4a_ d.68.4.1 (A:) hypothetical protein YhbY {Escherichia coli [TaxId: 562]} mdlstkqkqhlkglahplkpvvllgsngltegvlaeieqalehhelikvkiatedretkt liveaivretgacnvqvigktlvlyrptkerkislple
Timeline for d1ln4a_: