![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
![]() | Family b.3.3.1: VHL [49469] (2 proteins) |
![]() | Protein VHL [49470] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49471] (7 PDB entries) |
![]() | Domain d1lm8v_: 1lm8 V: [74035] Other proteins in same PDB: d1lm8b_, d1lm8c_ complexed with Hif-1alpha oxyproline peptide (chain H) |
PDB Entry: 1lm8 (more details), 1.85 Å
SCOPe Domain Sequences for d1lm8v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lm8v_ b.3.3.1 (V:) VHL {Human (Homo sapiens) [TaxId: 9606]} rpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlf rdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrld ivrslyedledhpnvqkdlerltqeriahq
Timeline for d1lm8v_: