SCOP 1.75: Domain d1lm8v_: 1lm8 V:

Lineage for d1lm8v_ (1lm8 V:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)

5. Family b.3.3.1: VHL [49469] (1 protein)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (3 PDB entries)

8. Domain d1lm8v_: 1lm8 V: [74035]
   Other proteins in same PDB: d1lm8b_, d1lm8c_
   complexed with Hif-1alpha oxyproline peptide (chain H)
   complexed with hyp

Details for d1lm8v_

PDB Entry: 1lm8, 1.85 Å

PDB Description: structure of a hif-1a-pvhl-elonginb-elonginc complex

PDB Compounds: (V:) von hippel-lindau disease tumor suppressor

SCOP Domain Sequences for d1lm8v_:

Sequence; same for both SEQRES and ATOM records:

>d1lm8v_ b.3.3.1 (V:) VHL {Human (Homo sapiens) [TaxId: 9606]}
rpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlf
rdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrld
ivrslyedledhpnvqkdlerltqeriahq

Timeline for d1lm8v_:

• d1lm8v_ first appeared in SCOP 1.61
  
• d1lm8v_ appears in SCOP 1.73
  
• d1lm8v_ appears in SCOPe 2.01
  
• d1lm8v_ appears in the current release, SCOPe 2.08