Lineage for d1lm8v_ (1lm8 V:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162042Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 162115Superfamily b.3.3: VHL [49468] (1 family) (S)
  5. 162116Family b.3.3.1: VHL [49469] (1 protein)
  6. 162117Protein VHL [49470] (1 species)
  7. 162118Species Human (Homo sapiens) [TaxId:9606] [49471] (3 PDB entries)
  8. 162119Domain d1lm8v_: 1lm8 V: [74035]
    Other proteins in same PDB: d1lm8b_, d1lm8c_

Details for d1lm8v_

PDB Entry: 1lm8 (more details), 1.85 Å

PDB Description: structure of a hif-1a-pvhl-elonginb-elonginc complex

SCOP Domain Sequences for d1lm8v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lm8v_ b.3.3.1 (V:) VHL {Human (Homo sapiens)}
rpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlf
rdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrld
ivrslyedledhpnvqkdlerltqeriahq

SCOP Domain Coordinates for d1lm8v_:

Click to download the PDB-style file with coordinates for d1lm8v_.
(The format of our PDB-style files is described here.)

Timeline for d1lm8v_: