Lineage for d1lm8c_ (1lm8 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411215Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1411216Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1411217Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1411266Protein Elongin C [54699] (3 species)
  7. 1411269Species Human (Homo sapiens) [TaxId:9606] [54700] (18 PDB entries)
  8. 1411270Domain d1lm8c_: 1lm8 C: [74034]
    Other proteins in same PDB: d1lm8b_, d1lm8v_

Details for d1lm8c_

PDB Entry: 1lm8 (more details), 1.85 Å

PDB Description: structure of a hif-1a-pvhl-elonginb-elonginc complex
PDB Compounds: (C:) elongin c

SCOPe Domain Sequences for d1lm8c_:

Sequence, based on SEQRES records: (download)

>d1lm8c_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d1lm8c_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d1lm8c_:

Click to download the PDB-style file with coordinates for d1lm8c_.
(The format of our PDB-style files is described here.)

Timeline for d1lm8c_: