Lineage for d1lm8b_ (1lm8 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402170Protein Elongin B [54246] (2 species)
  7. 1402171Species Human (Homo sapiens) [TaxId:9606] [54247] (16 PDB entries)
  8. 1402172Domain d1lm8b_: 1lm8 B: [74033]
    Other proteins in same PDB: d1lm8c_, d1lm8v_

Details for d1lm8b_

PDB Entry: 1lm8 (more details), 1.85 Å

PDB Description: structure of a hif-1a-pvhl-elonginb-elonginc complex
PDB Compounds: (B:) elongin b

SCOPe Domain Sequences for d1lm8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lm8b_ d.15.1.1 (B:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq

SCOPe Domain Coordinates for d1lm8b_:

Click to download the PDB-style file with coordinates for d1lm8b_.
(The format of our PDB-style files is described here.)

Timeline for d1lm8b_: