Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (26 proteins) Pfam 00240 |
Protein Elongin B [54246] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (3 PDB entries) |
Domain d1lm8b_: 1lm8 B: [74033] Other proteins in same PDB: d1lm8c_, d1lm8v_ complexed with hyp |
PDB Entry: 1lm8 (more details), 1.85 Å
SCOP Domain Sequences for d1lm8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lm8b_ d.15.1.1 (B:) Elongin B {Human (Homo sapiens)} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq
Timeline for d1lm8b_: