Lineage for d1lm8b_ (1lm8 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598490Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
    Pfam 00240
  6. 598500Protein Elongin B [54246] (1 species)
  7. 598501Species Human (Homo sapiens) [TaxId:9606] [54247] (3 PDB entries)
  8. 598502Domain d1lm8b_: 1lm8 B: [74033]
    Other proteins in same PDB: d1lm8c_, d1lm8v_
    complexed with hyp

Details for d1lm8b_

PDB Entry: 1lm8 (more details), 1.85 Å

PDB Description: structure of a hif-1a-pvhl-elonginb-elonginc complex

SCOP Domain Sequences for d1lm8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lm8b_ d.15.1.1 (B:) Elongin B {Human (Homo sapiens)}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq

SCOP Domain Coordinates for d1lm8b_:

Click to download the PDB-style file with coordinates for d1lm8b_.
(The format of our PDB-style files is described here.)

Timeline for d1lm8b_: