Lineage for d1llza3 (1llz A:1-422)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988341Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 2988342Protein Alpha subunit of glutamate synthase, N-terminal domain [69833] (2 species)
  7. 2988352Species Synechocystis sp. [TaxId:1143] [75566] (5 PDB entries)
  8. 2988358Domain d1llza3: 1llz A:1-422 [74022]
    Other proteins in same PDB: d1llza1, d1llza2
    complexed with f3s, fmn
    has additional subdomain(s) that are not in the common domain

Details for d1llza3

PDB Entry: 1llz (more details), 3 Å

PDB Description: Structural studies on the synchronization of catalytic centers in glutamate synthase: reduced enzyme
PDB Compounds: (A:) Ferredoxin-dependent glutamate synthase

SCOPe Domain Sequences for d1llza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llza3 d.153.1.1 (A:1-422) Alpha subunit of glutamate synthase, N-terminal domain {Synechocystis sp. [TaxId: 1143]}
cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
iq

SCOPe Domain Coordinates for d1llza3:

Click to download the PDB-style file with coordinates for d1llza3.
(The format of our PDB-style files is described here.)

Timeline for d1llza3: