Lineage for d1llqb2 (1llq B:2-295)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398612Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 398613Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 398746Family c.58.1.3: Mitochondrial NAD(P)-dependent malic enzyme [53240] (1 protein)
    this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 398747Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 398808Species Pig roundworm (Ascaris suum) [TaxId:6253] [75254] (2 PDB entries)
  8. 398812Domain d1llqb2: 1llq B:2-295 [74011]
    Other proteins in same PDB: d1llqa1, d1llqb1
    complexed with nad

Details for d1llqb2

PDB Entry: 1llq (more details), 2.3 Å

PDB Description: Crystal Structure of Malic Enzyme from Ascaris suum Complexed with Nicotinamide Adenine Dinucleotide

SCOP Domain Sequences for d1llqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llqb2 c.58.1.3 (B:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum)}
svahhedvyshnlppmdekemalyklyrpervtpkkrsaellkeprlnkgmgfslyerqy
lglhgllppafmtqeqqayrvitklreqpndlaryiqldglqdrneklfyrvvcdhvkel
mpivytptvglacqnfgyiyrkpkglyitindnsvskiyqilsnwheedvraivvtdger
ilglgdlgaygigipvgklalyvalggvqpkwclpvlldvgtnnmdllndpfyiglrhkr
vrgkdydtlldnfmkactkkygqktliqfedfanpnafrlldkyqdkytmfndd

SCOP Domain Coordinates for d1llqb2:

Click to download the PDB-style file with coordinates for d1llqb2.
(The format of our PDB-style files is described here.)

Timeline for d1llqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1llqb1