Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) |
Family c.58.1.3: Mitochondrial NAD(P)-dependent malic enzyme [53240] (1 protein) this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand |
Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species) |
Species Pig roundworm (Ascaris suum) [TaxId:6253] [75254] (2 PDB entries) |
Domain d1llqb2: 1llq B:2-295 [74011] Other proteins in same PDB: d1llqa1, d1llqb1 complexed with nad |
PDB Entry: 1llq (more details), 2.3 Å
SCOP Domain Sequences for d1llqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llqb2 c.58.1.3 (B:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum)} svahhedvyshnlppmdekemalyklyrpervtpkkrsaellkeprlnkgmgfslyerqy lglhgllppafmtqeqqayrvitklreqpndlaryiqldglqdrneklfyrvvcdhvkel mpivytptvglacqnfgyiyrkpkglyitindnsvskiyqilsnwheedvraivvtdger ilglgdlgaygigipvgklalyvalggvqpkwclpvlldvgtnnmdllndpfyiglrhkr vrgkdydtlldnfmkactkkygqktliqfedfanpnafrlldkyqdkytmfndd
Timeline for d1llqb2: