SCOP 1.75: Domain d1llha_: 1llh A:

Lineage for d1llha_ (1llh A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (446 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d1llha_: 1llh A: [74007]
   complexed with cl, seo; mutant

Details for d1llha_

PDB Entry: 1llh, 1.8 Å

PDB Description: are carboxy terminii of helices coded by the local sequence or by tertiary structure contacts

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1llha_:

Sequence; same for both SEQRES and ATOM records:

>d1llha_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgiwdayk

Timeline for d1llha_:

• d1llha_ first appeared in SCOP 1.61
  
• d1llha_ appears in SCOP 1.73
  
• d1llha_ appears in SCOPe 2.01
  
• d1llha_ appears in the current release, SCOPe 2.08