Lineage for d1lk5c2 (1lk5 C:131-210)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 193084Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 193085Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 193086Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (2 species)
  7. 193087Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75449] (2 PDB entries)
  8. 193090Domain d1lk5c2: 1lk5 C:131-210 [73965]
    Other proteins in same PDB: d1lk5a1, d1lk5b1, d1lk5c1, d1lk5d1

Details for d1lk5c2

PDB Entry: 1lk5 (more details), 1.75 Å

PDB Description: Structure of the D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii

SCOP Domain Sequences for d1lk5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk5c2 d.58.40.1 (C:131-210) D-ribose-5-phosphate isomerase (RpiA), lid domain {Archaeon Pyrococcus horikoshii}
cqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfiidakfpriddp
ldmeielntipgviengifa

SCOP Domain Coordinates for d1lk5c2:

Click to download the PDB-style file with coordinates for d1lk5c2.
(The format of our PDB-style files is described here.)

Timeline for d1lk5c2: