Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein) share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits |
Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species) |
Species Pyrococcus horikoshii [TaxId:53953] [75179] (2 PDB entries) |
Domain d1lk5c1: 1lk5 C:1-130,C:211-229 [73964] Other proteins in same PDB: d1lk5a2, d1lk5b2, d1lk5c2, d1lk5d2 complexed with cl, na |
PDB Entry: 1lk5 (more details), 1.75 Å
SCOPe Domain Sequences for d1lk5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk5c1 c.124.1.4 (C:1-130,C:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl vderklvdylXdiadivivgtregvkkler
Timeline for d1lk5c1: