Lineage for d1lk5c1 (1lk5 C:1-130,C:211-229)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922494Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
    share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits
  6. 2922495Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species)
  7. 2922506Species Pyrococcus horikoshii [TaxId:53953] [75179] (2 PDB entries)
  8. 2922509Domain d1lk5c1: 1lk5 C:1-130,C:211-229 [73964]
    Other proteins in same PDB: d1lk5a2, d1lk5b2, d1lk5c2, d1lk5d2
    complexed with cl, na

Details for d1lk5c1

PDB Entry: 1lk5 (more details), 1.75 Å

PDB Description: Structure of the D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii
PDB Compounds: (C:) D-Ribose-5-Phosphate Isomerase

SCOPe Domain Sequences for d1lk5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk5c1 c.124.1.4 (C:1-130,C:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa
kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl
vderklvdylXdiadivivgtregvkkler

SCOPe Domain Coordinates for d1lk5c1:

Click to download the PDB-style file with coordinates for d1lk5c1.
(The format of our PDB-style files is described here.)

Timeline for d1lk5c1: