SCOP 1.61: Domain d1lk5b2: 1lk5 B:131-210

Lineage for d1lk5b2 (1lk5 B:131-210)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family)

5. Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)

6. Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (2 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75449] (2 PDB entries)

8. Domain d1lk5b2: 1lk5 B:131-210 [73963]
   Other proteins in same PDB: d1lk5a1, d1lk5b1, d1lk5c1, d1lk5d1

Details for d1lk5b2

PDB Entry: 1lk5, 1.75 Å

PDB Description: Structure of the D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii

SCOP Domain Sequences for d1lk5b2:

Sequence; same for both SEQRES and ATOM records:

>d1lk5b2 d.58.40.1 (B:131-210) D-ribose-5-phosphate isomerase (RpiA), lid domain {Archaeon Pyrococcus horikoshii}
cqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfiidakfpriddp
ldmeielntipgviengifa

Timeline for d1lk5b2:

• d1lk5b2 is new in SCOP 1.61
  
• d1lk5b2 appears in SCOP 1.63
  
• d1lk5b2 appears in the current release, SCOPe 2.08