SCOP 1.67: Domain d1lk3l2: 1lk3 L:107-210

Lineage for d1lk3l2 (1lk3 L:107-210)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries)

8. Domain d1lk3l2: 1lk3 L:107-210 [73957]
   Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3h2, d1lk3i1, d1lk3i2, d1lk3l1, d1lk3m1

Details for d1lk3l2

PDB Entry: 1lk3, 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

SCOP Domain Sequences for d1lk3l2:

Sequence; same for both SEQRES and ATOM records:

>d1lk3l2 b.1.1.2 (L:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr

Timeline for d1lk3l2:

• d1lk3l2 first appeared in SCOP 1.61
  
• d1lk3l2 appears in SCOP 1.65
  
• d1lk3l2 appears in SCOP 1.69
  
• d1lk3l2 appears in the current release, SCOPe 2.08