Lineage for d1lk3l1 (1lk3 L:1-106)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288262Species Rat (Rattus norvegicus) [TaxId:10116] [88532] (7 PDB entries)
  8. 288263Domain d1lk3l1: 1lk3 L:1-106 [73956]
    Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3h2, d1lk3i1, d1lk3i2, d1lk3l2, d1lk3m2

Details for d1lk3l1

PDB Entry: 1lk3 (more details), 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

SCOP Domain Sequences for d1lk3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus)}
dtvltqppaltvspgekltisckasesvtsrmhwyqqkpgqqpklliykasnlasgvpar
fsgsgsgtdftltidpveaddtaiyfcqqswngpltfgagtklelk

SCOP Domain Coordinates for d1lk3l1:

Click to download the PDB-style file with coordinates for d1lk3l1.
(The format of our PDB-style files is described here.)

Timeline for d1lk3l1: