Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Anti-IL-10 Fab 9D7 (rat), kappa L chain [74820] (1 PDB entry) |
Domain d1lk3h1: 1lk3 H:1-119 [73952] Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h2, d1lk3i2, d1lk3l2, d1lk3m2 |
PDB Entry: 1lk3 (more details), 1.91 Å
SCOP Domain Sequences for d1lk3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk3h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Anti-IL-10 Fab 9D7 (rat), kappa L chain} qvnllqsgaalvkpgasvklsckasgytftdfyihwvkqshgkslewigyinpnsgytny nekfknkatltvdkststgymelsrltsedsanysctrgvpgnnwfpywgqgtlvtvss
Timeline for d1lk3h1: