Lineage for d1ljna_ (1ljn A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405486Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 405538Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 406012Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 406014Domain d1ljna_: 1ljn A: [73940]
    complexed with cbs, so4

Details for d1ljna_

PDB Entry: 1ljn (more details), 1.19 Å

PDB Description: crystal structure of turkey egg lysozyme complex with di-n- acetylchitobiose at 1.19a resolution

SCOP Domain Sequences for d1ljna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljna_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOP Domain Coordinates for d1ljna_:

Click to download the PDB-style file with coordinates for d1ljna_.
(The format of our PDB-style files is described here.)

Timeline for d1ljna_: