SCOPe 2.08: Domain d1li5a1: 1li5 A:316-402

Lineage for d1li5a1 (1li5 A:316-402)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Cysteinyl-tRNA synthetase (CysRS) [74709] (1 species)
   contains extra C-terminal alpha+beta subdomain: [alpha(2)-beta(2)], ordered in the complex with tRNA

7. Species Escherichia coli [TaxId:562] [74710] (3 PDB entries)
   Uniprot P21888; extra C-terminal subdomain: 407-461

8. Domain d1li5a1: 1li5 A:316-402 [73912]
   Other proteins in same PDB: d1li5a2, d1li5b2
   complexed with zn

Details for d1li5a1

PDB Entry: 1li5, 2.3 Å

PDB Description: Crystal Structure of Cysteinyl-tRNA Synthetase

PDB Compounds: (A:) cysteinyl-tRNA synthetase

SCOPe Domain Sequences for d1li5a1:

Sequence; same for both SEQRES and ATOM records:

>d1li5a1 a.27.1.1 (A:316-402) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
lerlytalrgtdktvapaggeafearfieamdddfntpeaysvlfdmarevnrlkaedma
aanamashlrklsavlglleqepeafl

Timeline for d1li5a1:

• d1li5a1 first appeared in SCOP 1.61
  
• d1li5a1 appears in SCOPe 2.07