SCOP 1.61: Domain d1li1c2: 1li1 C:115-229

Lineage for d1li1c2 (1li1 C:115-229)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.169: C-type lectin-like [56435] (1 superfamily)
Superfamily d.169.1: C-type lectin-like [56436] (6 families)
Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
Protein Noncollagenous (NC1) domain of collagen IV [75586] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [75587] (1 PDB entry)
Domain d1li1c2: 1li1 C:115-229 [73903]

Details for d1li1c2

PDB Entry: 1li1 (more details), 1.9 Å

PDB Description: The 1.9-A crystal structure of the noncollagenous (NC1) domain of human placenta collagen IV shows stabilization via a novel type of covalent Met-Lys cross-link

SCOP Domain Sequences for d1li1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li1c2 d.169.1.6 (C:115-229) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens)}
aiaiavhsqdvsiphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfi
ecnggrgtchyyankysfwlttipeqsfqgspsadtlkaglirthisrcqvcmknl

SCOP Domain Coordinates for d1li1c2:

Click to download the PDB-style file with coordinates for d1li1c2.
(The format of our PDB-style files is described here.)

Timeline for d1li1c2: