Lineage for d1lfmb_ (1lfm B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 210025Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 210079Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (5 PDB entries)
  8. 210082Domain d1lfmb_: 1lfm B: [73884]
    complexed with coh

Details for d1lfmb_

PDB Entry: 1lfm (more details), 1.5 Å

PDB Description: crystal structure of cobalt(iii)-substituted cytochrome c (tuna)

SCOP Domain Sequences for d1lfmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfmb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d1lfmb_:

Click to download the PDB-style file with coordinates for d1lfmb_.
(The format of our PDB-style files is described here.)

Timeline for d1lfmb_: