SCOP 1.63: Domain d1lfma_: 1lfm A:

Lineage for d1lfma_ (1lfm A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (5 PDB entries)

8. Domain d1lfma_: 1lfm A: [73883]

Details for d1lfma_

PDB Entry: 1lfm, 1.5 Å

PDB Description: crystal structure of cobalt(iii)-substituted cytochrome c (tuna)

SCOP Domain Sequences for d1lfma_:

Sequence; same for both SEQRES and ATOM records:

>d1lfma_ a.3.1.1 (A:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d1lfma_:

• d1lfma_ first appeared in SCOP 1.61
  
• d1lfma_ appears in SCOP 1.65
  
• d1lfma_ appears in the current release, SCOPe 2.08