SCOP 1.75: Domain d1lekb_: 1lek B:

Lineage for d1lekb_ (1lek B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d1lekb_: 1lek B: [73874]
   Other proteins in same PDB: d1leka1, d1leka2
   complexed with cso, fuc, nag, po4

Details for d1lekb_

PDB Entry: 1lek, 2.15 Å

PDB Description: crystal structure of h-2kbm3 bound to dev8

PDB Compounds: (B:) Beta-2-microglobulin

SCOP Domain Sequences for d1lekb_:

Sequence; same for both SEQRES and ATOM records:

>d1lekb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1lekb_:

• d1lekb_ first appeared in SCOP 1.61, called d1lekb1
  
• d1lekb_ appears in SCOP 1.73
  
• d1lekb_ appears in SCOPe 2.01
  
• d1lekb_ appears in the current release, SCOPe 2.08