SCOP 1.67: Domain d1leka1: 1lek A:182-274

Lineage for d1leka1 (1lek A:182-274)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)

8. Domain d1leka1: 1lek A:182-274 [73872]
   Other proteins in same PDB: d1leka2, d1lekb_
   complexed with cso, fuc, nag, po4

Details for d1leka1

PDB Entry: 1lek, 2.15 Å

PDB Description: crystal structure of h-2kbm3 bound to dev8

SCOP Domain Sequences for d1leka1:

Sequence; same for both SEQRES and ATOM records:

>d1leka1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1leka1:

• d1leka1 first appeared in SCOP 1.61
  
• d1leka1 appears in SCOP 1.65
  
• d1leka1 appears in SCOP 1.69
  
• d1leka1 appears in the current release, SCOPe 2.08