Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Phospholipase A2 [48637] (5 species) |
Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (6 PDB entries) group X secretory phospholipase A2 |
Domain d1le6b_: 1le6 B: [73863] complexed with ca, mpd |
PDB Entry: 1le6 (more details), 1.97 Å
SCOPe Domain Sequences for d1le6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1le6b_ a.133.1.2 (B:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp kcd
Timeline for d1le6b_: