Lineage for d1ldke1 (1ldk E:3109-3149)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779427Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 779428Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 779429Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 779442Protein Skp2 [81379] (1 species)
  7. 779443Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries)
  8. 779458Domain d1ldke1: 1ldk E:3109-3149 [73857]
    Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2
    complexed with zn

Details for d1ldke1

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
PDB Compounds: (E:) SKP2-like protein type gamma

SCOP Domain Sequences for d1ldke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldke1 a.158.1.1 (E:3109-3149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw

SCOP Domain Coordinates for d1ldke1:

Click to download the PDB-style file with coordinates for d1ldke1.
(The format of our PDB-style files is described here.)

Timeline for d1ldke1: