Class a: All alpha proteins [46456] (284 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (4 proteins) |
Protein Skp2 [81379] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries) |
Domain d1ldke1: 1ldk E:3109-3149 [73857] Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2 complexed with zn |
PDB Entry: 1ldk (more details), 3.1 Å
SCOP Domain Sequences for d1ldke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldke1 a.158.1.1 (E:3109-3149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw
Timeline for d1ldke1: