![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
![]() | Superfamily a.158.1: F-box domain [81383] (1 family) ![]() |
![]() | Family a.158.1.1: F-box domain [81381] (3 proteins) |
![]() | Protein Skp2 [81379] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81377] (4 PDB entries) |
![]() | Domain d1ldke1: 1ldk E:3109-3149 [73857] Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2 complexed with zn |
PDB Entry: 1ldk (more details), 3.1 Å
SCOP Domain Sequences for d1ldke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldke1 a.158.1.1 (E:3109-3149) Skp2 {Human (Homo sapiens)} wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw
Timeline for d1ldke1: