| Class g: Small proteins [56992] (90 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins) |
| Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries) Uniprot P62877 19-106 |
| Domain d1ldkc_: 1ldk C: [73854] Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkd1, d1ldkd2, d1ldke1 complexed with zn |
PDB Entry: 1ldk (more details), 3.1 Å
SCOPe Domain Sequences for d1ldkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldkc_ g.44.1.1 (C:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky
Timeline for d1ldkc_: