Lineage for d1ldka_ (1ldk A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155820Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies)
  4. 156131Superfamily a.118.17: Culin repeat [74788] (1 family) (S)
  5. 156132Family a.118.17.1: Culin repeat [74789] (1 protein)
  6. 156133Protein Culin homolog 1, Cul-1 [74790] (1 species)
  7. 156134Species Human (Homo sapiens) [TaxId:9606] [74791] (2 PDB entries)
  8. 156136Domain d1ldka_: 1ldk A: [73851]
    Other proteins in same PDB: d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2, d1ldke1

Details for d1ldka_

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

SCOP Domain Sequences for d1ldka_:

Sequence, based on SEQRES records: (download)

>d1ldka_ a.118.17.1 (A:) Culin homolog 1, Cul-1 {Human (Homo sapiens)}
igldqiwddlragiqqvytrqsmaksrymelythvynyctsvhqsnqargagvppskskk
gqtpggaqfvglelykrlkeflknyltnllkdgedlmdesvlkfytqqwedyrfsskvln
gicaylnrhwvrrecdegrkgiyeiyslalvtwrdclfrplnkqvtnavlkliekernge
tintrlisgvvqsyvelglneddafakgptltvykesfesqfladterfytresteflqq
npvteymkkaearlleeqrrvqvylhestqdelarkceqvliekhleifhtefqnlldad
knedlgrmynlvsriqdglgelkkllethihnqglaaiekcgeaalndpkmyvqtvldvh
kkynalvmsafnndagfvaaldkacgrfinnnavtk

Sequence, based on observed residues (ATOM records): (download)

>d1ldka_ a.118.17.1 (A:) Culin homolog 1, Cul-1 {Human (Homo sapiens)}
igldqiwddlragiqqvytrqsmaksrymelythvynyctsqfvglelykrlkeflknyl
tnllkdgedlmdesvlkfytqqwedyrfsskvlngicaylnrhwvrreckgiyeiyslal
vtwrdclfrplnkqvtnavlkliekerngetintrlisgvvqsyvelglnedltvykesf
esqfladterfytresteflqqnpvteymkkaearlleeqrrvqvylhestqdelarkce
qvliekhleifhtefqnlldadknedlgrmynlvsriqdglgelkkllethihnqglaai
ekcgeaalndpkmyvqtvldvhkkynalvmsafnndagfvaaldkacgrfinnnavtk

SCOP Domain Coordinates for d1ldka_:

Click to download the PDB-style file with coordinates for d1ldka_.
(The format of our PDB-style files is described here.)

Timeline for d1ldka_: