Class g: Small proteins [56992] (90 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (6 families) |
Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins) |
Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries) Uniprot P62877 19-106 |
Domain d1ldjb_: 1ldj B: [73850] Other proteins in same PDB: d1ldja1, d1ldja2, d1ldja3 complexed with zn |
PDB Entry: 1ldj (more details), 3 Å
SCOP Domain Sequences for d1ldjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldjb_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha fhfhcisrwlktrqvcpldnrewefqky
Timeline for d1ldjb_: