SCOP 1.71: Domain d1ldjb_: 1ldj B:

Lineage for d1ldjb_ (1ldj B:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (3 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (3 PDB entries)

8. Domain d1ldjb_: 1ldj B: [73850]
   Other proteins in same PDB: d1ldja1, d1ldja2, d1ldja3
   complexed with zn

Details for d1ldjb_

PDB Entry: 1ldj, 3 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex

SCOP Domain Sequences for d1ldjb_:

Sequence; same for both SEQRES and ATOM records:

>d1ldjb_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens)}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky

Timeline for d1ldjb_:

• d1ldjb_ first appeared in SCOP 1.61
  
• d1ldjb_ appears in SCOP 1.69
  
• d1ldjb_ appears in SCOP 1.73
  
• d1ldjb_ appears in the current release, SCOPe 2.08