Lineage for d1ldjb_ (1ldj B:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271595Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 271596Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) (S)
  5. 271597Family g.44.1.1: RING finger domain, C3HC4 [57851] (9 proteins)
  6. 271616Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 271617Species Human (Homo sapiens) [TaxId:9606] [75694] (2 PDB entries)
  8. 271618Domain d1ldjb_: 1ldj B: [73850]
    Other proteins in same PDB: d1ldja1, d1ldja2, d1ldja3
    complexed with zn

Details for d1ldjb_

PDB Entry: 1ldj (more details), 3 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex

SCOP Domain Sequences for d1ldjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldjb_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens)}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky

SCOP Domain Coordinates for d1ldjb_:

Click to download the PDB-style file with coordinates for d1ldjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ldjb_: