Lineage for d1ldja3 (1ldj A:411-686)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 619210Fold e.40: Cullin homology domain [75631] (1 superfamily)
    3 domains: (1) 4-helical bundle; (2) alpha+beta; (3) "winged helix"-like
  4. 619211Superfamily e.40.1: Cullin homology domain [75632] (1 family) (S)
  5. 619212Family e.40.1.1: Cullin homology domain [75633] (1 protein)
  6. 619213Protein Cullin homolog 1, cul-1 [75634] (1 species)
  7. 619214Species Human (Homo sapiens) [TaxId:9606] [75635] (3 PDB entries)
  8. 619215Domain d1ldja3: 1ldj A:411-686 [73849]
    Other proteins in same PDB: d1ldja1, d1ldja2, d1ldjb_
    complexed with zn

Details for d1ldja3

PDB Entry: 1ldj (more details), 3 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex

SCOP Domain Sequences for d1ldja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldja3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens)}
maqssskspellarycdsllkkssknpeeaeledtlnqvmvvfkyiedkdvfqkfyakml
akrlvhqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsep
ldldfsiqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgel
vtncfknrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllv
ledenanvdevelkpdtliklylgyknkklrvninv

SCOP Domain Coordinates for d1ldja3:

Click to download the PDB-style file with coordinates for d1ldja3.
(The format of our PDB-style files is described here.)

Timeline for d1ldja3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ldjb_