Lineage for d1ldja1 (1ldj A:687-776)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307385Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)
  6. 2307386Protein Anaphase promoting complex (APC) [74680] (2 species)
  7. 2307392Species Human (Homo sapiens) [TaxId:9606] [74682] (4 PDB entries)
    Uniprot Q13616 17-776
  8. 2307393Domain d1ldja1: 1ldj A:687-776 [73847]
    Other proteins in same PDB: d1ldja2, d1ldja3, d1ldjb_
    complexed with zn

Details for d1ldja1

PDB Entry: 1ldj (more details), 3 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
PDB Compounds: (A:) Cullin homolog 1

SCOPe Domain Sequences for d1ldja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldja1 a.4.5.34 (A:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]}
pmkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevltqlssrfkprv
pvikkcidiliekeylervdgekdtysyla

SCOPe Domain Coordinates for d1ldja1:

Click to download the PDB-style file with coordinates for d1ldja1.
(The format of our PDB-style files is described here.)

Timeline for d1ldja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ldjb_