![]() | Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
![]() | Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
![]() | Superfamily f.19.1: Aquaporin-like [81338] (1 family) ![]() |
![]() | Family f.19.1.1: Aquaporin-like [56895] (2 proteins) duplication: consist of two similar structural parts |
![]() | Protein Glycerol uptake facilitator protein GlpF [56898] (1 species) glycerol conducting channel, related to aquaporin |
![]() | Species Escherichia coli [TaxId:562] [56899] (4 PDB entries) |
![]() | Domain d1ldfa_: 1ldf A: [73845] complexed with bog, cry, mg; mutant |
PDB Entry: 1ldf (more details), 2.1 Å
SCOP Domain Sequences for d1ldfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldfa_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli} tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisvifglgvamaiyltagvsga hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl liavigasmgpltgtamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai vgafayrkligrhl
Timeline for d1ldfa_: