Lineage for d1ldfa_ (1ldf A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024308Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 3024309Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 3024310Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 3024343Protein Glycerol uptake facilitator protein GlpF [56898] (1 species)
    glycerol conducting channel, related to aquaporin
  7. 3024344Species Escherichia coli [TaxId:562] [56899] (4 PDB entries)
  8. 3024345Domain d1ldfa_: 1ldf A: [73845]
    complexed with bog, gol, mg; mutant

Details for d1ldfa_

PDB Entry: 1ldf (more details), 2.1 Å

PDB Description: crystal structure of the e. coli glycerol facilitator (glpf) mutation w48f, f200t
PDB Compounds: (A:) glycerol uptake facilitator protein

SCOPe Domain Sequences for d1ldfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldfa_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli [TaxId: 562]}
tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisvifglgvamaiyltagvsga
hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
liavigasmgpltgtamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
vgafayrkligrhl

SCOPe Domain Coordinates for d1ldfa_:

Click to download the PDB-style file with coordinates for d1ldfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ldfa_: