Lineage for d1lddc_ (1ldd C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307385Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)
  6. 2307386Protein Anaphase promoting complex (APC) [74680] (2 species)
  7. 2307387Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74681] (1 PDB entry)
  8. 2307390Domain d1lddc_: 1ldd C: [73843]

Details for d1lddc_

PDB Entry: 1ldd (more details), 2 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
PDB Compounds: (C:) Anaphase Promoting Complex

SCOPe Domain Sequences for d1lddc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lddc_ a.4.5.34 (C:) Anaphase promoting complex (APC) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
grlkyiangsyeiv

SCOPe Domain Coordinates for d1lddc_:

Click to download the PDB-style file with coordinates for d1lddc_.
(The format of our PDB-style files is described here.)

Timeline for d1lddc_: