SCOP 1.67: Domain d1ldaa_: 1lda A:

Lineage for d1ldaa_ (1lda A:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (1 family)

5. Family f.19.1.1: Aquaporin-like [56895] (4 proteins)
   duplication: consist of two similar structural parts

6. Protein Glycerol uptake facilitator protein GlpF [56898] (1 species)
   glycerol conducting channel, related to aquaporin

7. Species Escherichia coli [TaxId:562] [56899] (4 PDB entries)

8. Domain d1ldaa_: 1lda A: [73840]
   complexed with bog

Details for d1ldaa_

PDB Entry: 1lda, 2.8 Å

PDB Description: crystal structure of the e. coli glycerol facilitator (glpf) without substrate glycerol

SCOP Domain Sequences for d1ldaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ldaa_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli}
tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
vgafayrkligrhl

Timeline for d1ldaa_:

• d1ldaa_ first appeared in SCOP 1.61
  
• d1ldaa_ appears in SCOP 1.65
  
• d1ldaa_ appears in SCOP 1.69
  
• d1ldaa_ appears in the current release, SCOPe 2.08