Lineage for d1ldaa_ (1lda A:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267942Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 267943Superfamily f.19.1: Aquaporin-like [81338] (1 family) (S)
  5. 267944Family f.19.1.1: Aquaporin-like [56895] (2 proteins)
    duplication: consist of two similar structural parts
  6. 267952Protein Glycerol uptake facilitator protein GlpF [56898] (1 species)
    glycerol conducting channel, related to aquaporin
  7. 267953Species Escherichia coli [TaxId:562] [56899] (4 PDB entries)
  8. 267957Domain d1ldaa_: 1lda A: [73840]
    complexed with bog

Details for d1ldaa_

PDB Entry: 1lda (more details), 2.8 Å

PDB Description: crystal structure of the e. coli glycerol facilitator (glpf) without substrate glycerol

SCOP Domain Sequences for d1ldaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldaa_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli}
tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
vgafayrkligrhl

SCOP Domain Coordinates for d1ldaa_:

Click to download the PDB-style file with coordinates for d1ldaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ldaa_: