Lineage for d1ldaa_ (1lda A:)
- Root: SCOP 1.61
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (13 families) 
Family f.2.1.5: Aquaporin-like [56895] (2 proteins) Protein Glycerol uptake facilitator protein GlpF [56898] (1 species) Species Escherichia coli [TaxId:562] [56899] (4 PDB entries) 
Domain d1ldaa_: 1lda A: [73840]
Details for d1ldaa_
PDB Entry: 1lda (more details), 2.8 Å
PDB Description: crystal structure of the e. coli glycerol facilitator (glpf) without substrate glycerol
SCOP Domain Sequences for d1ldaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldaa_ f.2.1.5 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli}
tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
vgafayrkligrhl
SCOP Domain Coordinates for d1ldaa_:
Click to download the PDB-style file with coordinates for d1ldaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ldaa_:
- d1ldaa_ is new in SCOP 1.61
- d1ldaa_ appears in SCOP 1.63
- d1ldaa_ appears in the current release, SCOPe 2.08
View in 3D