Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins) |
Protein Mitochondrial serine protease HtrA2, catalytic domain [74971] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74972] (1 PDB entry) |
Domain d1lcya2: 1lcy A:6-210 [73835] Other proteins in same PDB: d1lcya1 mutant |
PDB Entry: 1lcy (more details), 2 Å
SCOP Domain Sequences for d1lcya2:
Sequence, based on SEQRES records: (download)
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv amgspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnaggplvnldgevi gvntmkvtagisfaipsdrlreflh
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv amgspfalqntitsgivssaqrpnveyiqtdaaidfgnaggplvnldgevigvntmkvta gisfaipsdrlreflh
Timeline for d1lcya2: