Lineage for d1lcya1 (1lcy A:226-325)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165991Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 165992Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
  5. 166052Family b.36.1.4: HtrA-like serine proteases [74933] (2 proteins)
  6. 166053Protein Mitochondrial serine protease HtrA2 [74936] (1 species)
  7. 166054Species Human (Homo sapiens) [TaxId:9606] [74937] (1 PDB entry)
  8. 166055Domain d1lcya1: 1lcy A:226-325 [73834]
    Other proteins in same PDB: d1lcya2

Details for d1lcya1

PDB Entry: 1lcy (more details), 2 Å

PDB Description: Crystal Structure of the Mitochondrial Serine Protease HtrA2

SCOP Domain Sequences for d1lcya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens)}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte

SCOP Domain Coordinates for d1lcya1:

Click to download the PDB-style file with coordinates for d1lcya1.
(The format of our PDB-style files is described here.)

Timeline for d1lcya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcya2