SCOPe 2.06: Domain d1lc3a2: 1lc3 A:129-246

Lineage for d1lc3a2 (1lc3 A:129-246)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.4: Biliverdin reductase [55373] (1 protein)
   automatically mapped to Pfam PF09166

6. Protein Biliverdin reductase [55374] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55375] (3 PDB entries)

8. Domain d1lc3a2: 1lc3 A:129-246 [73826]
   Other proteins in same PDB: d1lc3a1
   complexed with nad, po4

Details for d1lc3a2

PDB Entry: 1lc3, 1.5 Å

PDB Description: Crystal Structure of a Biliverdin Reductase Enzyme-Cofactor Complex

PDB Compounds: (A:) biliverdin reductase a

SCOPe Domain Sequences for d1lc3a2:

Sequence; same for both SEQRES and ATOM records:

>d1lc3a2 d.81.1.4 (A:129-246) Biliverdin reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
meefeflrrevlgkellkgslrftaspleeerfgfpafsgisrltwlvslfgelslisat
leerkedqymkmtvqletqnkgllswieekgpglkrnryvnfqftsgsleevpsvgvn

Timeline for d1lc3a2:

• d1lc3a2 first appeared in SCOP 1.61
  
• d1lc3a2 appears in SCOPe 2.05
  
• d1lc3a2 appears in SCOPe 2.07
  
• d1lc3a2 appears in the current release, SCOPe 2.08