Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Biliverdin reductase [51823] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [51824] (3 PDB entries) |
Domain d1lc3a1: 1lc3 A:2-128,A:247-293 [73825] Other proteins in same PDB: d1lc3a2 |
PDB Entry: 1lc3 (more details), 1.5 Å
SCOP Domain Sequences for d1lc3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lc3a1 c.2.1.3 (A:2-128,A:247-293) Biliverdin reductase {Rat (Rattus norvegicus)} mitnsgkfgvvvvgvgragsvrlrdlkdprsaaflnligfvsrrelgsldevrqisleda lrsqeidvayicsessshedyirqflqagkhvlveypmtlsfaaaqelwelaaqkgrvlh eehvellXkniflkdqdifvqklldqvsaedlaaekkrimhclglasdiqklchq
Timeline for d1lc3a1: