Lineage for d1lbka1 (1lbk A:77-208)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153151Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (33 PDB entries)
  8. 153191Domain d1lbka1: 1lbk A:77-208 [73809]
    Other proteins in same PDB: d1lbka2, d1lbkb2

Details for d1lbka1

PDB Entry: 1lbk (more details), 1.86 Å

PDB Description: crystal structure of a recombinant glutathione transferase, created by replacing the last seven residues of each subunit of the human class pi isoenzyme with the additional c-terminal helix of human class alpha isoenzyme

SCOP Domain Sequences for d1lbka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbka1 a.45.1.1 (A:77-208) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpmdeksl

SCOP Domain Coordinates for d1lbka1:

Click to download the PDB-style file with coordinates for d1lbka1.
(The format of our PDB-style files is described here.)

Timeline for d1lbka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lbka2