Lineage for d1lb1d_ (1lb1 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846785Protein RhoA [52612] (1 species)
  7. 1846786Species Human (Homo sapiens) [TaxId:9606] [52613] (23 PDB entries)
    Uniprot P61586 2-181
  8. 1846810Domain d1lb1d_: 1lb1 D: [73789]
    Other proteins in same PDB: d1lb1a1, d1lb1a2, d1lb1c1, d1lb1c2, d1lb1e1, d1lb1e2, d1lb1g1, d1lb1g2

Details for d1lb1d_

PDB Entry: 1lb1 (more details), 2.81 Å

PDB Description: crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa
PDB Compounds: (D:) transforming protein rhoa

SCOPe Domain Sequences for d1lb1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb1d_ c.37.1.8 (D:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d1lb1d_:

Click to download the PDB-style file with coordinates for d1lb1d_.
(The format of our PDB-style files is described here.)

Timeline for d1lb1d_: