Lineage for d1lb1d_ (1lb1 D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179673Protein RhoA [52612] (1 species)
  7. 179674Species Human (Homo sapiens) [TaxId:9606] [52613] (7 PDB entries)
  8. 179681Domain d1lb1d_: 1lb1 D: [73789]
    Other proteins in same PDB: d1lb1a1, d1lb1a2, d1lb1c1, d1lb1c2, d1lb1e1, d1lb1e2, d1lb1g1, d1lb1g2

Details for d1lb1d_

PDB Entry: 1lb1 (more details), 2.81 Å

PDB Description: Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA

SCOP Domain Sequences for d1lb1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb1d_ c.37.1.8 (D:) RhoA {Human (Homo sapiens)}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOP Domain Coordinates for d1lb1d_:

Click to download the PDB-style file with coordinates for d1lb1d_.
(The format of our PDB-style files is described here.)

Timeline for d1lb1d_: