Lineage for d1la2d2 (1la2 D:323-437)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203521Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2203603Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2203611Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)
    Uniprot P11986
  8. 2203633Domain d1la2d2: 1la2 D:323-437 [73780]
    Other proteins in same PDB: d1la2a1, d1la2b1, d1la2c1, d1la2d1
    complexed with nad

Details for d1la2d2

PDB Entry: 1la2 (more details), 2.65 Å

PDB Description: structural analysis of saccharomyces cerevisiae myo-inositol phosphate synthase
PDB Compounds: (D:) myo-inositol-1-phosphate synthase

SCOPe Domain Sequences for d1la2d2:

Sequence, based on SEQRES records: (download)

>d1la2d2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records): (download)

>d1la2d2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksviddiiasndilyndkl
gkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

SCOPe Domain Coordinates for d1la2d2:

Click to download the PDB-style file with coordinates for d1la2d2.
(The format of our PDB-style files is described here.)

Timeline for d1la2d2: