Lineage for d1la1a_ (1la1 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310107Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 310214Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 310215Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 310216Protein GroEL, A domain [52031] (3 species)
  7. 310217Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 310225Domain d1la1a_: 1la1 A: [73772]

Details for d1la1a_

PDB Entry: 1la1 (more details), 2.06 Å

PDB Description: gro-el fragment (apical domain) comprising residues 188-379

SCOP Domain Sequences for d1la1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1la1a_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli}
dvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpl
liiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigm
elekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqe
rvaklaggvavi

SCOP Domain Coordinates for d1la1a_:

Click to download the PDB-style file with coordinates for d1la1a_.
(The format of our PDB-style files is described here.)

Timeline for d1la1a_: